PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001819.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 136aa    MW: 15512.6 Da    PI: 4.3999
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001819.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB64.42.4e-202751487
                    NF-YB 14 srimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
                             ++i+k++lP + ++++d+++++ ec +efi +++se+++ c++e+++ti+++ +l al  lGf +y+e++ +  
  Itr_sc001819.1_g00005.1  2 TKIIKEMLPPDVRVARDCQDLLIECCVEFINLISSESNEVCNKEDKRTIAPEHVLKALEVLGFGEYIEEVYAAY 75
                             68******************************************************************986533 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.88E-302123IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.2E-332121IPR009072Histone-fold
PfamPF008081.7E-17259IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MTKIIKEMLP PDVRVARDCQ DLLIECCVEF INLISSESNE VCNKEDKRTI APEHVLKALE  60
VLGFGEYIEE VYAAYEQHKF ETMQDSVRGG KWSNVVEMTE EEALAAQQRM FAEARARMNN  120
GITVPKQSEP EQNTNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-31111521133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007037755.17e-83Nuclear factor Y, subunit B13 isoform 2
SwissprotP495926e-80NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A061FYD77e-83A0A061FYD7_THECC; Nuclear factor Y, subunit B13 isoform 2
STRINGGLYMA05G07750.13e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.24e-81nuclear factor Y, subunit B13